Logo SpriteLoader

Safarihub.net SEO Report Last updated on WebRankPage Download

Limited Time Offer! Get Lifetime Account at Just $99 Sign Up


Top 5 Things to Do with your WebPage


SEO Report Summary

  • 00/00 Successfully Passed Parameters
  • 00/00 Very Low Impact Parameters
  • 00/00 Low Impact Parameters
  • 00/00 Medium Impact Parameters
  • 00/00 High Impact Parameters
  • 00/00 Very High Impact SEO Parameter
- Failed

Basic Analysis


Safari Hub: African Safari Blog with Tips & Advice

Great! You have a Title tag on your webpage and it is less than 70 chars.

Meta Desc

The Safari Hub is the resourceful guide to planning an African safari. Get to know the best destinations, things to see and do, travel tips and advice.

Great that you have a Meta Description tag, this is generally what users see on search engine results when they find your page.

Google Preview

Safari Hub: African Safari Blog with Tips & Advice
The Safari Hub is the resourceful guide to planning an African safari. Get to know the best destinations, things to see and do, travel tips and advice.

Meta Keywords


Keep your keywords limited, although these don't affect your Search Engine standings especially in Google.



Not having the DocType specified although causes no issues with modern web-browsers, but there's always Internet Explorer to worry about.



Again this helps in rendering special characters, it helps users and your SEO score as well.



Making the Search Engine aware of the language of your website increases readability of your webpage. Kudos here!

Dublin Core


Load Analysis




Consider having a favicon for your website to make it distinguishable in bookmarks, open tabs etc.

URL Analysis

Your URL's are perfectly formed, no need to change that.

Gzip Compression


Sure thing, this will help your page load faster, reduce wait time and possibly increase pageviews.

Domain Age and Validity


HTML Code Analysis



You should incorporate more textual content in your website, but if your website is not content based then try to focus on the little content that you have to make it keyword rich and matching in context to your webpage.


Its great that you are using proper headings on your webpage, it gives structure and also becomes more readable to the search crawler.


Your webpage contains 41 image(s) and out of which 16 don't have alt attribute.

# Code
1 <img class="td-retina-data" data-retina="https://www.safarihub.net/wp-content/uploads/2020/02/safari-hub.png" src="https://www.safarihub.net/wp-content/uploads/2020/02/safari-hub.png" alt="">
2 <img src="https://www.safarihub.net/wp-content/uploads/2020/02/rec-header.jpg">
3 <img src="https://www.safarihub.net/wp-content/uploads/2020/02/logo-other.png" alt="">
4 <img class="td-retina-data" data-retina="https://www.safarihub.net/wp-content/uploads/2020/02/safari-hub.png" src="https://www.safarihub.net/wp-content/uploads/2020/02/safari-hub.png" alt="">
5 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_341x220.png" width="341" height="220">
6 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_341x220.png" width="341" height="220">
7 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_300x194.png" width="300" height="194">
8 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_180x135.png" width="180" height="135">
9 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_180x135.png" width="180" height="135">
10 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_180x135.png" width="180" height="135">
11 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_180x135.png" width="180" height="135">
12 <img src="https://www.safarihub.net/wp-content/uploads/2020/02/rec-sidebar.jpg">
13 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_100x75.png" width="100" height="75">
14 <img class="td-retina-data" src="https://www.safarihub.net/wp-content/uploads/2020/02/logo-other.png" data-retina="https://www.safarihub.net/wp-content/uploads/2020/02/logo-other-retina.png" alt="" title="" width="">
15 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_100x75.png" width="100" height="75">
16 <img class="entry-thumb" src="" alt="" data-type="image_tag" data-img-url="https://www.safarihub.net/wp-content/plugins/td-composer/legacy/Newsmag/assets/images/no-thumb/td_100x75.png" width="100" height="75">

Show more

An ALT attribute represents information about the image if it is not available or till its loading. It is a good practice to have an ALT attribute associated with all images, it helps in SEO as search engines can't see the image but can read the TITLE and ALT attributes.


# Keyword Frequency
1 safari 47
2 african 19
3 africa 16
4 admin 16
5 guides 13
6 tips 12
7 planning 12
8 national 12
9 password 9
10 reserve 9
11 news 9
12 uganda 8
13 safaris 8
14 october 8
15 wildlife 8
16 travel 8
17 finding 7
18 game 7
19 rental 7
20 car 7
21 guide 6
22 park 6
23 november 6
24 rwanda 6
25 okapi 6
26 deals 6
27 hub 6
28 affordable 6
29 parks 6
30 destinations 5
31 information 5
32 south 5
33 contact 5
34 tours 4
35 top 4
36 blog 4
37 september 4
38 sign 4
39 mother 4
40 republic 4
41 botswana 4
42 reserves 4
43 lake 4
44 exploring 4
45 find 4
46 april 4
47 planningsafaristravel 4
48 parksnewspackagesreviewssafari 4
49 reservesguidesnational 4
50 allaccommodationblogdestinationsgame 4
51 tanzania 4
52 kenya 3
53 photos 3
54 serengeti 3
55 tuli 3
56 countries 3
57 east 3
58 driving 3
59 pandemic 3
60 covid- 3
61 central 3
62 mburo 3

Show more


No tables.

THEAD section of a table, the table header is a great resource for the Search Engine crawler to identify the content of the table. Its great that you have a header for your table columns to identify them uniquely.

Inline CSS


WooHoo! No inline CSS. Not just it reduces page size and load time, but a separate CSS file can be cached by the browser as well.


No iFrames.

Nowadays, most social plugins use IFrames, and its content is not indexed therefore it doesn't matter much. But one should not put site's content in IFrames, which is always a good practice.


No Flash.

WooHoo! No Flash, although it is almost impossible to avoid flash when dealing with online video, it is avoidable in almost all other situations. Its great to see that you are going the right way.

Email Address

1 plain text email addresses.

You missed the mark here, email addresses in plain text are a beacon to spammers and scammers.

W3C Validity


Mobile Analysis

Upgrade to paid version for Mobile Analysis and Internal Page Analysis to improve your website SEO.

Social Analysis

Social Networking Service (SNS)

Social integration is extremely important and its great that you have a Facebook page, Twitter profile as well as a Google Plus page.

Social Share Count


Facebook Fan Page Info


Twitter Page Info



Internal vs External Links

Internal Links: 62, External Links: 8 and Nofollow Links: 0.

Show more

Page Indexed


Visitor Analysis

By Country



Security Status


Spammer Directory


Server Signature


Its good that you have your server signature off, it helps in securing your website.


Google Analytics


Google Adsense


Server Info

Web Server: LiteSpeed

Programming Language: PHP/7.2.34, PHP/7.2.34

Limited Time Offer! Get Lifetime Account at Just $99 Sign Up