Logo SpriteLoader

Gidroart.com.ua SEO Report Last updated on WebRankPage Download

Limited Time Offer! Get Lifetime Account at Just $99 Sign Up


Top 5 Things to Do with your WebPage


SEO Report Summary

  • 00/00 Successfully Passed Parameters
  • 00/00 Very Low Impact Parameters
  • 00/00 Low Impact Parameters
  • 00/00 Medium Impact Parameters
  • 00/00 High Impact Parameters
  • 00/00 Very High Impact SEO Parameter
- Failed

Basic Analysis


Интернет-магазин сантехники - Гидромассажные боксы Киев, Душевые боксы, Сантехника и Ванны

The title of your webpage is more than 70 characters long, the title should be precise and appropriate to the content of the page.

Meta Desc

ГидроАрт. Оптвая и розничная продажа гидромассажных боксов, гидробокс, душевых кабин, ванн, сантехники. Доставка по всей Украине. SWD Enjoy Apollo Flory Jacuzzi Presto Hidrocabin Miracle Sansa Caribe Lanmeng CRW

Although this is not relevant to Search Engine Optimization, but this text is shown in search results page, this is the first impression of your website the user sees. Therefore, it is recommended that you use this tag.

Google Preview

Интернет-магазин сантехники -...
ГидроАрт. Оптвая и розничная продажа гидромассажных боксов, гидробокс, душевых...

Meta Keywords

Гидробоксы, гидробокс, гидромассажные ванны, гидромассажные боксы, купить гидробокс, гидромассажные кабины, гидромассажные кабина, гидробоксы apollo, гидромассажные боксы киев, гидромассажные боксы в киеве, гидробоксы swd, гідробокси, гидробоксы в киеве, душевая, душевые кабины, душевые кабина, кабина душевая, душевые кабинки, куплю душевую кабину, душевые кабины купить, душевые кабины киев, душевая кабина цена, душевые кабины в киеве, интернет магазин душевые кабины, душевые кабины продажа, душевой бокс киев, душевые кабины купить, магазин сантехники, ванна, ванны, ванно, ванная, ванна в ванную, ванная фото, ванна купить, ванны гидромассажные, SWD Enjoy Apollo Flory Jacuzzi Presto Hidrocabin Miracle Sansa Caribe Lanmeng CRW

Although they are ignored by Search engines these days, doesn't hurt to have them on your website.



Good going, DocType will help your website render correctly on older-gen web browsers and well the bane of our existence Internet Explorer.



Again this helps in rendering special characters, it helps users and your SEO score as well.



Making the Search Engine aware of the language of your website increases readability of your webpage. Kudos here!

Dublin Core


Load Analysis



gidroart.com.ua favicon http://www.gidroart.com.ua/templates/wg_blank/favicon.ico

Great that you have a favicon, helps identify your website in bookmarks, tabs but has no impact on SEO.

URL Analysis

Your URL's are perfectly formed, no need to change that.

Gzip Compression


Since it is not very difficult to enable GZip compression, its benefits far outweigh the cost of implementation. Give it a try!

Domain Age and Validity


HTML Code Analysis



Text/HTML ratio should always be kept in balance, its great that you have it in check. More textual and unique content increases your search relevance.


Although not mandatory, proper heading structure is helpful to search crawlers in indexing your webpage and also giving proper importance to various sections of your page.


Your webpage contains 21 image(s) and out of which 6 don't have alt attribute.

# Code
1 <img src="/templates/wg_blank/images/banner.jpg" alt="">
2 <img src="//mc.yandex.ru/watch/5309122" style="position:absolute; left:-9999px;" alt="">
3 <img src="http://spravka.ua/img/buttons/17.gif" alt="">
4 <img src="http://prom.ua/image/bonus/buttons/b1b_ua.png" alt="" style="border: 0;">
5 <img src="http://bonbone.ru/bon.php?32842" alt="" width="88" height="31">
6 <img src="http://www.hit24.com.ua/k/1.gif?s=2219" alt="" width="88" height="31">

An ALT attribute represents information about the image if it is not available or till its loading. It is a good practice to have an ALT attribute associated with all images, it helps in SEO as search engines can't see the image but can read the TITLE and ALT attributes.


# Keyword Frequency
1 primera 5
2 devit 3
3 gidroart 3
4 laufen 3
5 villeroyboch 3
6 duravit 3
7 oransmiracleprimeraradawayrheinsansashiqikoloveronis 1
8 hansgrohe 1
9 caribedevitenjoyfabiogmgrandehomeravak 1
10 apolloaquastreamatlantisartexam-pmcaribedevitdusruxeagofabioflorygmgrandehomeoransmiraclesansashiqiswdsvserenatritonveronis 1
11 apolloam-pm 1
12 atlantisaquastreamcersanit 1
13 devitirisfibrextriton 1
14 oranskolokaldewei 1
15 royal 1
16 bathravak 1
17 veronis 1
18 cersanit 1
19 aquastreamapolloatlantisam-pm 1
20 enter 1

Show more


Your webpage contains 3 table(s) and 3 table(s) don't have thead section.

You do not have table headers, i.e. THEAD section in your tables, therefore, the crawler will not be able to interpret the content stored in tabular form and just read it as plain text rather than consolidated tabular data.

Inline CSS


WooHoo! No inline CSS. Not just it reduces page size and load time, but a separate CSS file can be cached by the browser as well.


No iFrames.

Nowadays, most social plugins use IFrames, and its content is not indexed therefore it doesn't matter much. But one should not put site's content in IFrames, which is always a good practice.


No Flash.

WooHoo! No Flash, although it is almost impossible to avoid flash when dealing with online video, it is avoidable in almost all other situations. Its great to see that you are going the right way.

Email Address

No plain text email address.

No email addresses in plain text, its great that you are protecting yours as well as your customers' information.

W3C Validity


Mobile Analysis

Upgrade to paid version for Mobile Analysis and Internal Page Analysis to improve your website SEO.

Social Analysis

Social Networking Service (SNS)

You are missing social impetus through Facebook, Twitter, Google+. You should have a Facebook page to keep your customers engaged. Twitter is a great source for Viral marketing. You are missing customers who wan't to engage with you on a social level. Although new, you can benefit from a Google Plus page as it directly ties in with various Google services and has relevance in search stats as well.

Social Share Count


Facebook Fan Page Info


Twitter Page Info



Internal vs External Links

Internal Links: 87, External Links: 16 and Nofollow Links: 11.

Show more

Show more

Page Indexed


Visitor Analysis

By Country



Security Status


Spammer Directory


Server Signature


Its good that you have your server signature off, it helps in securing your website.


Google Analytics


Google Adsense


Server Info

Web Server: N/A

Programming Language: N/A

Limited Time Offer! Get Lifetime Account at Just $99 Sign Up