Logo SpriteLoader

Cakephp.org SEO Report Last updated on WebRankPage Download

Limited Time Offer! Get Lifetime Account at Just $99 Sign Up


Top 5 Things to Do with your WebPage


SEO Report Summary

  • 00/00 Successfully Passed Parameters
  • 00/00 Very Low Impact Parameters
  • 00/00 Low Impact Parameters
  • 00/00 Medium Impact Parameters
  • 00/00 High Impact Parameters
  • 00/00 Very High Impact SEO Parameter
- Failed

Basic Analysis


CakePHP - Build fast, grow solid | PHP Framework | Home

Great! You have a Title tag on your webpage and it is less than 70 chars.

Meta Desc

CakePHP is an open-source web, rapid development framework that makes building web applications simpler, faster and require less code. It follows the model–view–controller (MVC) . Manual for beginners now available and links towards the last version.

Although this is not relevant to Search Engine Optimization, but this text is shown in search results page, this is the first impression of your website the user sees. Therefore, it is recommended that you use this tag.

Google Preview

CakePHP - Build fast, grow solid | PHP Framework | Home
CakePHP is an open-source web, rapid development framework that makes building web applications simpler,...

Meta Keywords


Keep your keywords limited, although these don't affect your Search Engine standings especially in Google.



Good going, DocType will help your website render correctly on older-gen web browsers and well the bane of our existence Internet Explorer.



Again this helps in rendering special characters, it helps users and your SEO score as well.



Making the Search Engine aware of the language of your website increases readability of your webpage. Kudos here!

Dublin Core


Load Analysis



cakephp.org favicon http://www.cakephp.org/pages?type=icon

Great that you have a favicon, helps identify your website in bookmarks, tabs but has no impact on SEO.

URL Analysis

Your URL's are perfectly formed, no need to change that.

Gzip Compression


Sure thing, this will help your page load faster, reduce wait time and possibly increase pageviews.

Domain Age and Validity


HTML Code Analysis



Text/HTML ratio should always be kept in balance, its great that you have it in check. More textual and unique content increases your search relevance.


Its great that you are using proper headings on your webpage, it gives structure and also becomes more readable to the search crawler.


Your webpage contains 33 image(s) and out of which 26 don't have alt attribute.

# Code
1 <img src="https://cakefest.org/cakefest/img/cakefest-logo.svg" width="93" alt="">
2 <img src="/img/cakefest-banner-online.png" alt="">
3 <img src="/img/hero_artwork.svg" alt="">
4 <img src="/img/whats_new.svg" alt="">
5 <img src="/img/build_quickly.svg" alt="">
6 <img src="/img/no_config.svg" alt="">
7 <img src="/img/license.svg" alt="">
8 <img src="/img/batteries_included.svg" alt="">
9 <img src="/img/mvc.svg" alt="">
10 <img src="/img/secure.svg" alt="">
11 <img src="/img/share_cake_bg.svg" alt="">
12 <img src="/img/cakedc.svg" class="logo" alt="">
13 <img src="/img/cakedc_expert.png" alt="">
14 <img src="/img/cakedc_training.png" alt="">
15 <img src="/img/cakedc_support.png" alt="">
16 <img src="/img/quote/megan.png" alt="">
17 <img src="/img/quote/brad.png" alt="">
18 <img src="/img/quote/julian.png" alt="">
19 <img src="/img/quote/dwayne.png" alt="">
20 <img src="/img/companies/logos.png" class="center-image" alt="">
21 <img src="/files/ScreenMonitorImages/file/0.66720300%201499201242/axiapayments.jpg" class="img-responsive" alt="">
22 <img src="/files/ScreenMonitorImages/file/0.54858800%201464039467/world-architects.jpg" class="img-responsive" alt="">
23 <img src="/files/ScreenMonitorImages/file/0.67975500%201464039480/childcare.jpg" class="img-responsive" alt="">
24 <img src="/img/sponsor_words.svg" class="sponsor-icon" alt="">
25 <img src="/images/companies/logos/sponsors/cakedc.jpg" alt="">
26 <img src="/images/companies/logos/sponsors/linode.jpg" alt="">

Show more

An ALT attribute represents information about the image if it is not available or till its loading. It is a good practice to have an ALT attribute associated with all images, it helps in SEO as search engines can't see the image but can read the TITLE and ALT attributes.


# Keyword Frequency
1 cakephp 37
2 support 10
3 framework 9
4 cakedc 9
5 development 8
6 community 8
7 faster 5
8 applications 4
9 security 4
10 business 4
11 build 4
12 developers 4
13 php 4
14 application 4
15 cakephpcakefestnewsletterlinkedinyoutubefacebooktwitter 3
16 app 3
17 features 3
18 email 3
19 learn 3
20 commercial 3
21 rapid 3
22 overflowircslackdiscordpaid 3
23 forumstack 3
24 documentation 3
25 bakeryfeatured 3
26 github 3
27 involvedissues 3
28 response 3
29 cake 3
30 services 3
31 solutions 3
32 trademarks 3
33 policylogos 3
34 issuesprivacy 3
35 bookapivideosreporting 3

Show more


No tables.

THEAD section of a table, the table header is a great resource for the Search Engine crawler to identify the content of the table. Its great that you have a header for your table columns to identify them uniquely.

Inline CSS


WooHoo! No inline CSS. Not just it reduces page size and load time, but a separate CSS file can be cached by the browser as well.


Your webpage contains 3 iFrame(s).

Nowadays, most social plugins use IFrames, and its content is not indexed therefore it doesn't matter much. But one should not put site's content in IFrames, which is always a good practice.


No Flash.

WooHoo! No Flash, although it is almost impossible to avoid flash when dealing with online video, it is avoidable in almost all other situations. Its great to see that you are going the right way.

Email Address

No plain text email address.

No email addresses in plain text, its great that you are protecting yours as well as your customers' information.

W3C Validity


Mobile Analysis

Upgrade to paid version for Mobile Analysis and Internal Page Analysis to improve your website SEO.

Social Analysis

Social Networking Service (SNS)

Social integration is extremely important and its great that you have a Facebook page, Twitter profile as well as a Google Plus page.

Social Share Count


Facebook Fan Page Info


Twitter Page Info



Internal vs External Links

Internal Links: 32, External Links: 29 and Nofollow Links: 0.

Show more

Show more

Page Indexed


Visitor Analysis

By Country



Security Status


Spammer Directory


Server Signature


Its good that you have your server signature off, it helps in securing your website.


Google Analytics


Google Adsense


Server Info

Web Server: cloudflare

Programming Language: N/A

Limited Time Offer! Get Lifetime Account at Just $99 Sign Up